SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A286Y3M1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A286Y3M1
Domain Number 1 Region: 43-172
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.4e-49
Family Calponin-homology domain, CH-domain 0.000000574
Further Details:      
 
Domain Number 2 Region: 242-302
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 1.15e-18
Family EB1 dimerisation domain-like 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A286Y3M1
Sequence length 326
Comment (tr|A0A286Y3M1|A0A286Y3M1_CAVPO) Microtubule associated protein RP/EB family member 2 {ECO:0000313|Ensembl:ENSCPOP00000032309} KW=Complete proteome; Reference proteome OX=10141 OS=Cavia porcellus (Guinea pig). GN=MAPRE2 OC=Hystricomorpha; Caviidae; Cavia.
Sequence
MPGPTQTLSPNGENNNDIIQDNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRH
DIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLL
QASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPP
PDPGEQIFNLPKKSHHANSPTAGAAKSSPASKPGSTPSRPSSAKRASSSGSASKSDKDLE
TQVIQLNEQVHSLKLALEGAEKERDFYFGKLREIELLCQEHGQENDDLVQRLMEVLYASE
EQEGHTEEPEAEEQAHDQQAQQQEEY
Download sequence
Identical sequences A0A286Y3M1
ENSCPOP00000003533 XP_003474133.1.53824 10141.ENSCPOP00000003533 ENSCPOP00000003533

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]