SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287B716 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287B716
Domain Number 1 Region: 46-135
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-39
Family SCAN domain 0.0000434
Further Details:      
 
Domain Number 2 Region: 377-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.18e-28
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 3 Region: 433-490
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 4 Region: 321-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.57e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-20
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 475-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.97e-19
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A287B716
Sequence length 534
Comment (tr|A0A287B716|A0A287B716_PIG) Zinc finger protein 397 {ECO:0000313|Ensembl:ENSSSCP00000052312} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ZNF397 OC=Sus.
Sequence
MAVESRAVSTPVPQNPQEQELILVKVEESLSWGQKFKQNGSTRSCQELFRQQFRKFCYQE
TPGPREALGRLQELCYQWLRPEVHTKEQILELLVLEQFLSILPEELQIWVQQHSPKSGEE
AVTLLEDLEREFDDPGQQVPASPQGPAVPWKDMPCLGPSQDLTDIQLQPLKTQLKPREPC
LSPQSDCKHKESATKKDISKEKSQRPSQEPSFGRVSEHESILEWPQGSAAGQKLRQCPSQ
GTGFSQVIFTHKALGNRDHHEPQRSLILSTNSVTCQKVPSEERPYTCDVCGHSFKQHSSL
TQHQRTHTGEKPYKCNQCGKAFSLRSYLIIHQRIHSGEKAYECSECGKAFNQSSALIRHR
KIHTGEKACKCNECGKAFSQSSYLIIHQRIHTGEKPYECNECGKTFSQSSKLIRHQRIHT
GERPYECNECGKAFRQSSELITHQRIHSGEKPYECNECGKAFSLSSNLIRHQRIHSGEEP
YQCNECGKTFKRSSALVQHQRIHSGDEAYICNECGKAFRHRSVLLRHQRVHTVK
Download sequence
Identical sequences A0A287B716
XP_013854746.1.46622 9823.ENSSSCP00000004047 ENSSSCP00000004047 ENSSSCP00000004047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]