SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287BH57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287BH57
Domain Number 1 Region: 1142-1318
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-41
Family BCR-homology GTPase activation domain (BH-domain) 0.00055
Further Details:      
 
Domain Number 2 Region: 704-819
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.19e-35
Family Pyk2-associated protein beta ARF-GAP domain 0.0013
Further Details:      
 
Domain Number 3 Region: 926-1057
Classification Level Classification E-value
Superfamily PH domain-like 1.77e-21
Family Pleckstrin-homology domain (PH domain) 0.015
Further Details:      
 
Domain Number 4 Region: 453-593
Classification Level Classification E-value
Superfamily PH domain-like 1.23e-19
Family Pleckstrin-homology domain (PH domain) 0.0000168
Further Details:      
 
Domain Number 5 Region: 1453-1588
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-17
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 
Domain Number 6 Region: 603-703
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000214
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 
Domain Number 7 Region: 5-75
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000507
Family SAM (sterile alpha motif) domain 0.0000598
Further Details:      
 
Domain Number 8 Region: 1034-1134
Classification Level Classification E-value
Superfamily PH domain-like 0.000000159
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287BH57
Sequence length 1735
Comment (tr|A0A287BH57|A0A287BH57_PIG) ArfGAP with RhoGAP domain, ankyrin repeat and PH domain 2 {ECO:0000313|Ensembl:ENSSSCP00000055924} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=ARAP2 OC=Sus.
Sequence
MSSVSEVNVDIKDFLMSINLEQYLLRFREFGFNNVMDCTGINDSVLLKVGISPTGHRRRI
LKQLQIILSKMQDIPVYANVHKAKKSDETSDDHHAPPSDQNRCVELSDSHGVPTPSPVPS
EPVTKNLDQNEASVENSQSLKSDDKLTLPTHNLPLPEEEPHLNSGSFQDSLFGSEITEVE
SLMDKKPMDCTTEEEQTEVDLMSENMSKLPHADSEFLSTPGCSLSEAHSGNETNGLLERS
PPPSFFQFQGEMVVNDLYVPSSPVVTPVRSQSKLVSGPSRSFLLRHRPVPEIPGSKTGIS
GSYFHERRNVPTSTGRSVTQQNSNEENSSSILPYGETFLFQKLENSKKKSIKNEFWMHEE
TPKGETTTERSSFFVKSSIYDNRTENITEDKVEDIWIPRQDKNNLPIDSASESEYSTVEE
CFQSLRRKNSKPSKSRTQKALNLDPVNRHSYPLSSTSGNADSSIISSNVISPYACFYGSS
VKKVKSGWLDKLCPQGKRMFQKRWVKFDGVSISYYNNDKGEKIKPKKWKIRRRKSYSEKY
SKGIIPLSAISTVRVQGDNKFEVVTTQRTFVFRVEKEEERNDWISILLNALKLQALSSQS
QAAVAPEKCGYLELRGYKAKIFTVLSGNSVWLCKNEQDFKSGLGITIIPMNVANVKQVDR
TAKQSFEIITPYRSFSFTAESEKEKQEWIEAVQQSIAETLSDYEVAEKIWFNESNRSCAD
CKAPDPDWASINLCVVICKKCAGQHRSLGPKDSKVRSLKMDASIWSNELIELFIVIGNKR
ANDFWAGNLQKEEELHVDSPVEKRKNFITQKYKEGRFRKTLLASLTKEELNKALCAAVVK
PDVLETMALLFSGADVMCATGDPEHSTPYLLAKKAGQSLQMEFLYHNKFSDFPQHDIHSE
GGLSQESSPSMFLCDFLYQAPAAASKLSSEKKLLEETNKKWCVLEGGFLSYYESDKSTTP
NGTININDVICLAVNKEDFCINTGPIFTFEIYLPSERAFLFGAETSQAQRKWTEAIAKHF
VPFVAENLTEADYDLIGQLYYKDCHALDQWRKGWFAMDKSSLRFCLQMQEGQEDRMNLRR
LQELTISTMVQNGEKLDVLLLVEKGRTLYIHGHTKLDFTVWHIAIEKAAGTDGNALQDQQ
LSKNDVPIIVNSCIAFVTQYGLGCKYIYQKNGDPLHISELLESFKKDARSFKLRAGKHQL
EDVTGVLKCFLSDIDDALLTKELYPYWISALDTQDDKERIKKYGAFIRTLPGVNRATLAA
LIEHLYRVQKCSEINHMNAHNLALVFSSCLFQTKGQTSEEVNVIEDLINNYVEIFEVKED
QVKQMDIENSFITKWKDTQVSQAGDLLIEVYVERKEPDCSIIIRISPVMEAEELTTDILA
IKNIIPMKDDIWATFEVIENEELERPLHYTENVLEQVLRWSSLAEPGAAYLVVKRFLTID
TIKHYNERKTLENIKEGVLKIKEEPSKILSGNKFQDRYFILRDAYLFLYKDLKSSKPDKM
LSVSSMKFYLGVKKKMKPPTSWGLTAYSEKHHWHLCCDSSQTQMEWMAYVFIAQHENDLW
PPAGKERKRSITKNPKIGGLPLIPIQHERNATQARREIESARAELERLRLGAKHELELGD
GTLKERASLVAQCLEHKDEKLRNRTRKHRSFNCLEDTETEVFQGQEKSHKGVKTLRKTED
RNGKATLDSNNKLPPKVIEELSVVLQRSRILAKELQGCLSKLVCIKSPLLQSVQS
Download sequence
Identical sequences A0A287BH57

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]