SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287BN35 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287BN35
Domain Number 1 Region: 5-40
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000153
Family BAFF receptor-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A287BN35
Sequence length 178
Comment (tr|A0A287BN35|A0A287BN35_PIG) TNF receptor superfamily member 17 {ECO:0000313|Ensembl:ENSSSCP00000058034} KW=Complete proteome; Reference proteome OX=9823 OS=Sus scrofa (Pig). GN=TNFRSF17 OC=Sus.
Sequence
MAQQCYQNEYFDRLLIACKPCRLRCSNTPPVTCQHYCNTMKGTNVILWTCLGLSLIVSLT
VFILMFLLRKRSSGPLRDELRNPGSVPQKGAGADLGNGSEGRMGAETLLSRGLEYTVEEC
TCEDCVQSEPKVDSDHFFPLPAMEEGATILVTTKTNGYCSSLLAAESALALEKSISTR
Download sequence
Identical sequences A0A287BN35
ENSSSCP00000008421 XP_003124635.1.46622 ENSSSCP00000008421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]