SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287D0H8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287D0H8
Domain Number 1 Region: 44-229,353-470
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.7e-51
Family FAD-linked reductases, N-terminal domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287D0H8
Sequence length 476
Comment (tr|A0A287D0H8|A0A287D0H8_ICTTR) Coenzyme Q10 monooxygenase 6 {ECO:0000256|HAMAP-Rule:MF_03193} KW=Complete proteome; Reference proteome OX=43179 OS=(Spermophilus tridecemlineatus). GN=COQ6 OC=Sciuridae; Xerinae; Marmotini; Ictidomys.
Sequence
MVARVSVMAARVSRTGWAIAFTAARRSPLISCRRCSSVSADTVYDVVVSGGGLVGAAMAC
ALGHDIHFRDKKILLLEAGPKRVLEKLSETYSNRVSSISPGSATLLSSFGAWDHICNMRY
RAFRRMQVWDACSEALIMFDKDNLDDMGYIVENDVIMHALTKQLEAVSDRVTVLYRSKAV
GYTWPGPFSMADSSPWVHITLGDGSTLQTKLLIGADGYNSGVRQAAGIQNVSWNYDQSAV
VATLHLSEATENNVAWQRFLPSGPIALLPLSDTLSSLVWSTSHDHAAELVSMDEEEFVDA
INSAFWSDANHVDFIDSAGTMLQYVVTLLKPTKVSARQLPPSVAKVDAKSRVLFPLGLGH
AAEYVRPRVALIGDAAHRVHPLAGQGVNMGFGDISSLVHHLSTAAFNGKDLGSMSHLASY
ETDRQRHNTALLAATDLLKRLYSTRAPPLVLLRTWGLQATNAMSPLKEQIMAFASK
Download sequence
Identical sequences A0A287D0H8
ENSSTOP00000014716 XP_005321278.1.77405 ENSSTOP00000014716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]