SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A287DVG9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A287DVG9
Domain Number 1 Region: 3-180
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.74e-40
Family PAPS reductase-like 0.0029
Further Details:      
 
Domain Number 2 Region: 250-359
Classification Level Classification E-value
Superfamily Thioredoxin-like 6.8e-21
Family PDI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A287DVG9
Sequence length 361
Comment (tr|A0A287DVG9|A0A287DVG9_HORVV) Uncharacterized protein {ECO:0000313|EnsemblPlants:HORVU0Hr1G003890.7} KW=Complete proteome; Reference proteome OX=112509 OS=Hordeum vulgare subsp. vulgare (Domesticated barley). GN= OC=Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum.
Sequence
MDRALDMFGSEIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYQLFDKVEKHY
GIHIEYMFPEASEVQDLVRTKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKD
QSPGTRASIPVVQVDPSFEGLDGGAGSLIKWNPVANVDGKDIWTFLRTMDVPVNTLHAQG
YVSIGCEPCTRPVLPGQHEREGRWWWEDATAKECGLHKGNIDKEGQTPKVGVNGNGSAEA
SAPDIFQSQAIVNLTRPGIENLLRLENRAEPWLAVLYAPWCPYCQAMEASYVELAEQLSG
SGIKVAKFRADGEQKSFAQAELQLQSFPTILLFPGRTVKPIKYPSEKRDVQSLLAFVNTL
R
Download sequence
Identical sequences A0A287DVG9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]