SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A292GMN5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A292GMN5
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 1.44e-37
Family SMI1/KNR4-like 0.00000375
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A292GMN5
Sequence length 152
Comment (tr|A0A292GMN5|A0A292GMN5_9BACI) SMI1 / KNR4 family protein {ECO:0000313|EMBL:BBA72137.1} OX=1882659 OS=Bacillus sp. FW1. GN= OC=Bacteria; Firmicutes; Bacilli; Bacillales; Bacillaceae; Bacillus.
Sequence
MDYSTIQKFLEENKEFSIITGGVSEKEIHEIEEELEVSLPESYKWFLKEYGSGGAYGTMI
LGYDSEGAEVVEQTKEYRTFYGLIPGLVVIEYIDEFSYCLDTNRMVDGECPVILWDNSEG
YGYTAACNFLEFFLQRLEKGKEDLDEDEDWED
Download sequence
Identical sequences A0A292GMN5 A0A2I7T3P0 I0F0S0
WP_014662893.1.22408 WP_014662893.1.27155 WP_014662893.1.77994 WP_014662893.1.91225 gi|386757116|ref|YP_006230332.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]