SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A3EEN2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A3EEN2
Domain Number 1 Region: 34-113
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 4.32e-21
Family Chemosensory protein Csp2 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A3EEN2
Sequence length 117
Comment (tr|A0A2A3EEN2|A0A2A3EEN2_APICC) Ejaculatory bulb-specific protein {ECO:0000313|EMBL:PBC30215.1} OX=94128 OS=Apis cerana cerana (Oriental honeybee). GN=APICC_09381 OC=Apoidea; Apidae; Apis.
Sequence
MASAIKALLIVCALLVYTVTAETEEGQSGRSRVSDEQLNMALSDQRYLRRQLKCALGEAP
CDPVGRRLKSLAPLVLRGACPQCSPEETRQIKKVLSHIQRTYPKEWSKIVQQYAGVS
Download sequence
Identical sequences A0A2A3EEN2 V9IK59
XP_016920181.1.2121

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]