SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4J653 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4J653
Domain Number 1 Region: 322-595
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.79e-48
Family Eukaryotic proteases 0.0006
Further Details:      
 
Domain Number 2 Region: 195-264
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000639
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 3 Region: 2-35
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000123
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 4 Region: 33-72
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000131
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 137-175
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000537
Family LDL receptor-like module 0.0028
Further Details:      
 
Domain Number 6 Region: 100-135
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000497
Family LDL receptor-like module 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2A4J653
Sequence length 596
Comment (tr|A0A2A4J653|A0A2A4J653_HELVI) Uncharacterized protein {ECO:0000313|EMBL:PCG66903.1} KW=Complete proteome; Reference proteome OX=7102 OS=Heliothis virescens (Tobacco budworm moth). GN=B5V51_7102 OC=Noctuoidea; Noctuidae; Heliothinae; Heliothis.
Sequence
ADEFQCKYGKCIPAAGRCNGTAECKDGSDETFVLCRNNTCPELDFRCTYGACMNSSVRCN
GKKDCADNSDEVIPLCRNDFTDFNICTERLIDDRQLSRAVDCNNLRLKCDNGQVLKEPTR
CDGHVDCEDGSDETLARCAEAECVPPLFRCAYGGCAFPKAACDGIEDCADGSDESFELCG
RELPSKTTTTPKPVCTLPPQPQNGSYVMGGTVQGVPGQTFSSFMLKYTCDEPYELLGAST
LFCFNGQWTEELPKCVRFCKLPKHPTVTYLCQISGDDVFNGYRECDEKEPEGTVVDPQCR
QPVYYYPGNLRYMRCIDGEWDQLITCIPECGRLGTPADALLLGSQGREARRNELPWHVAI
YRRPHHTQICSGTIVKNDVVISAAHCFWNVRGLHPVSNYVVAAGKLYRTWNHPNDSNAQT
SDIREISVPVRFQGSATSFQDDISLVKLVSSLEYSVHVRPVCIDFDFNFDSRQLKVFSVG
KIAGWGRTASGNFSEVLRVADVPYVSIQDCISDTPAGFRVYITSDKICAGYKNGTALCEG
DSGGGLTFPARERGTIRYYLRGVASTAVNNQRLCNEATITSFTHVVTHAQFILEHL
Download sequence
Identical sequences A0A2A4J653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]