SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4JY55 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4JY55
Domain Number 1 Region: 2033-2083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000307
Family Laminin-type module 0.016
Further Details:      
 
Domain Number 2 Region: 2367-2419
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000237
Family Laminin-type module 0.01
Further Details:      
 
Domain Number 3 Region: 2475-2528
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000279
Family Laminin-type module 0.0028
Further Details:      
 
Domain Number 4 Region: 1052-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000419
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 5 Region: 1943-1991
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000276
Family Laminin-type module 0.0068
Further Details:      
 
Domain Number 6 Region: 2425-2477
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000419
Family Laminin-type module 0.043
Further Details:      
 
Domain Number 7 Region: 2528-2577
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000781
Family Laminin-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1194-1241
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000165
Family Laminin-type module 0.014
Further Details:      
 
Domain Number 9 Region: 1294-1344
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000502
Family Laminin-type module 0.0097
Further Details:      
 
Domain Number 10 Region: 1149-1196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000809
Family Laminin-type module 0.021
Further Details:      
 
Domain Number 11 Region: 1098-1137
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000017
Family Laminin-type module 0.055
Further Details:      
 
Domain Number 12 Region: 1347-1386
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000248
Family Laminin-type module 0.037
Further Details:      
 
Domain Number 13 Region: 706-763
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.076
Further Details:      
 
Domain Number 14 Region: 892-949
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000307
Family Laminin-type module 0.076
Further Details:      
 
Domain Number 15 Region: 2575-2624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000335
Family Laminin-type module 0.027
Further Details:      
 
Domain Number 16 Region: 646-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000419
Family Laminin-type module 0.049
Further Details:      
 
Domain Number 17 Region: 2081-2129
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000446
Family Laminin-type module 0.0084
Further Details:      
 
Domain Number 18 Region: 962-1009
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000279
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 19 Region: 1007-1047
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000446
Family Laminin-type module 0.0093
Further Details:      
 
Domain Number 20 Region: 776-823
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000753
Family Laminin-type module 0.048
Further Details:      
 
Domain Number 21 Region: 1239-1291
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000949
Family Laminin-type module 0.0058
Further Details:      
 
Domain Number 22 Region: 2325-2369
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000977
Family Laminin-type module 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A4JY55
Sequence length 3304
Comment (tr|A0A2A4JY55|A0A2A4JY55_HELVI) Uncharacterized protein {ECO:0000313|EMBL:PCG76322.1} KW=Complete proteome; Reference proteome OX=7102 OS=Heliothis virescens (Tobacco budworm moth). GN=B5V51_9787 OC=Noctuoidea; Noctuidae; Heliothinae; Heliothis.
Sequence
MLWTPVTDKFNKNLPKEIGDVNDTDEEEGGEEVSNNNNVGMNWIPVNFEIADDSAHIEEE
ENIESGEFEDNLQSNSRIHTISMSDYVIHTIPTNRDIAHHRYFSAMPGILREGETESITG
TTTYSVTEPSTSSETETETTTTTTTTTTTTTTPTTTITTETPANDMTEPMETTSSVNVFT
TTTGPGPGPGTGPGPGTGTYDNTVTTDTYVTADNTDTATTTIVITTTTAATPPPPIRCYQ
CGLNVSDIPDVPTCYHIFEDSDRRYRHLRARHRVVCEKKETLLRKNVTQYDTSPDRLFKG
GCFKRFLDIGNDVYNERGCRTMNPIRGKSFASGRFRLLEKSMHHIREGCVSSPHASLTPF
SRAVTLYARPHSAPGRRPRSMAGAHITFLVLVCAALVHTEVLTPRYFNLASKKKITATAT
CGDEGPELYCKLVGANADHDEHVIQGQVCDICDATNEAKKHPPEYAVDSSETWWQSPPLS
RGMKYNEVNLTIDLGQEFHVAYVFVKMGNSPRPGLWMLEKSTDYGKTFKPWQYFSESPQD
CERYFGKESLQPITKDDSVICSTEYSKIVPLEGGEIPISLLNYRPSANTYFNSSVLQEWT
RATNVRLRLLRTKNLLGHLMSVARQDPTVTRRYFYSIKDISIGGRCMCNGHADTCEPADP
ATNSNILECVCQHNTCGPQCAECCRGFEQKKWRISQHWDRFTCEPCNCHNHSTECEYDPE
VDRQKLSLDIYGKYEGGGVCKNCQHNTQGINCNKCMPTYYRPQGKSWNETDVCQPCNCDL
HFSTGNCEDLSGWCECRVEFKPPNCDSCAYGYFDFPNCKPCTCNLNGTDGQQCTPVDGLF
ISCVSNSLXSNILECVCQHNTCGPQCAECCRGFEQKKWRISQHWDRFTCEPCNCHNHSTE
CEYDPEVDRQKLSLDIYGKYEGGGVCKNCQHNTQGINCNKCMPTYYRPQGKSWNETDVCQ
PCNCDLHFSTGNCEDLSGWCECRVEFKPPNCDSCAYGYFDFPNCKPCTCNLNGTDGQQCT
PVDGLCPCKYNYAGKSCEICADGYYSPECKNCECNSVGSVSPVCDKDSGNCTCKSKYSGR
TCNQCEYGYYNYPTCKHCNCDVSGTQARICDDIDGTCICKTGFGGARCDQCLNGFYMEVR
DRERLCVPCNCDSTGSTSTSCSADGKCNCLANFGGKQCDQCSPGYYKYPECLPCNCDVSG
SIGSTCDDNGQCHCKPNFDGAKCDKCKEQYYNYPACEECNCDPRGVIASFAGCGSVPAGE
LCQCKDRVQGRICNDCKPLFWNLQEYNPFGCEDCNCHLAGTLGGLGSCNTRSGQCRCKMN
VGDRQCNQCQDGFYKLDSNNVYGCTECDCDIGGSIDNNCDKNTGQCRCHSRVEGRRCDRP
IRAHYFPTLHQFQYEVEEGYTQSGPVRYRNSEEVFPDYSWKGYVVFSMLQNEVTNRVLIP
KSSLYRMVLKYANPLQDTVIASIIVTPDSIGDIQQKFNVALRPTNKPQLVTVAGDKGVAP
SPFVMNPGSWMITIKTTKEVMIDYFVLIPEAYYEATVLTKLVDKPCIIGDKKLCRHFAYP
SLFGRPTADVSGLSTSVTGYIDDVEQLNELQASAESIPILTNDEIQYNMKIDPPGPYILI
IEYVTPINRTAESANEIEIAYNTSYSFAPRGPITVRFQSGDQQETDAIVNLNDCPYTAAC
RQAVVDDLSKIQVFNIQEANNVIYLMGDRDTLVGIKSIVAIPETEWHLDYITPRPYCLRR
NGKCEPANFAASVDSKKIEIETGTGGDRDIRPPTLDNATAVIYLIPDVEPVKIESKIPAA
GDYMFMVHYYQPVHPESTINVAVKTDSQQFDTNMVVQHCPSITGCRSLLKLSDGTKQFPV
ADNFTITFWGNNSKGLWIDYVLVIAAPDFVDAALTEANVVDYTREFIEKCANNHYHIGSN
ETGFCRDAMFSITAEYNSGALACVCDFMGSTELECNNFGGQCPCKPNVIGRSCSACRTGY
YGFPNCRPCHCPSTAICDDNGMCICPKNVEGENCDRCKPYTFNFDVQRGCDNCNCNSLGV
VDNQLQCEADSGNCACRENVIGRTCDHCVPGHYAFPECVPCTCDRDGTTDDVCDQSTAQC
YCKRYVTGQACDTCVEEYFNLQSSNPEGCTKCYCFGRTTRCTSSYLYWASISGMADWYLV
NVEANRTLNIFPRTILPVMKNDSTITADLVGDDSGQKVVYFGAPDYYLGKRLTSYGGYLT
YSIFYETGLDGGAIAAADVIIGGSDGYLVHNSVEQPPSKVEWTHAVRLSEDEFSNSDGSQ
VSREQFMNTLVNVTSIYIRATYWDQSVETSLIAVTLDIGVEGYEEYIDAKRASSVEECQC
PKAYRGLSCEQCAEGYYRLSSGFCVPCQCNGHSRECDVNTGVCLECTDNTMGDHCEQCIP
GYHGDALAGTPRDCLICACPLPYVSNNFAIGCDLSDNGSLISCQCKPGYGGARCEFCAAG
YYGEPEVIGDYCKPCNCSGNININDPGSCDSHNGECLKCVNNTAGHACNLCAPGFFGDAI
FSKNCTACSCDEFGMERCDPATGTCVCRPGVIGDRCDQCAPNHWGLNSGQGCTPCDCDLA
SESAQCDLTTGQCSCAKGVTGKHCEQCAAGYWNYTKEGCDHCNCNTGYSLGFTCNATGQC
ECLPGVVGEKCDRCPERWVLIPNEGCLECDSCTDALLITIENMGERLANETKDFKDKADS
FFTTQRLNYIANQTQSLRPKVAELKNVDVADVTTAVKTLENSAKNLLRSAEFAATDSDKQ
ITRAADLAADADKILASVRDSSEKAKAIVTHVADLATGLELSQQPKVDSALAEARQIKSD
IAAKDLAPKKQQADIAFSNATKQIERMNVFVQPVNEQAKKFQLLVNNTRDLKTKLDEMLQ
YTDLAQHTATTAQNLNAKNRQSKFGNKVASVTKLNAAAMQDLIDAGYDIGNGTFYNLVAA
TVVDNSTKALDSIRTANQDMIDRLDDLENKLPELRNLTEVANHHTYMLRNRADNLRALAE
RENNNSRTQHAYTAASAYSSIVQEIGDAKKAADDADEGVRNITQLTNELNNRVVPARDRS
RNLLEAATKAQNIVEQALSPNLTKAEEKLAHAQKTMGSADDDNNAIQFSLRTPPPFSLDS
EVEAADKVNSTVQTTLEVMSQVGADLAASKEWAQTLPKLADEAQKMTATVDSLGLDGNVK
LSISGDSTTDQQIYVHSKEAFFLAKITIFQPGSAEVQIVRGRSTSDAKLQSCFSFRRLRG
TNCKELRLETTPVGLWNFASAENLKGEPAEYCTATEEPVPPVLQEYAPDGLIYTSLEKEP
PSSL
Download sequence
Identical sequences A0A2A4JY55

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]