SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A4M7A7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A4M7A7
Domain Number 1 Region: 27-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.97e-45
Family DsbA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A4M7A7
Sequence length 212
Comment (tr|A0A2A4M7A7|A0A2A4M7A7_9BURK) Thiol:disulfide interchange protein {ECO:0000256|PIRNR:PIRNR001488} OX=2030806 OS=Burkholderiaceae bacterium. GN=COC14_07975 OC=Burkholderiaceae.
Sequence
MKKIAALLATVAAVSGLLMTAPAAMAAPTEGKDYTVLKSPQPVPAGKIEVTEFFWYGCPH
CYDFEPELEAWVKKQGKDVVFKRVPVAFRDDLLPHTKIFYALEAMGKLDAMHTKVFDAIH
KQRKRLLTTDEIADFMAQNGIDKKQWLDTYNSFSVTTNSQRANKIADAYKIDGVPTVVVQ
GKYETSPSIAGTKPGAIQAMDFLVTGVRDKKL
Download sequence
Identical sequences A0A132HAZ1 A0A2A4M7A7 Q1LS92
WP_011515019.1.12480 WP_011515019.1.22474 WP_011515019.1.25839 WP_011515019.1.38154 WP_011515019.1.481 WP_011515019.1.52493 WP_011515019.1.66126 gi|94309043|ref|YP_582253.1| 266264.Rmet_0098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]