SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6C8Y6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6C8Y6
Domain Number 1 Region: 615-856
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.49e-43
Family Ankyrin repeat 0.0000332
Further Details:      
 
Domain Number 2 Region: 158-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000265
Family EGF-type module 0.013
Further Details:      
 
Domain Number 3 Region: 88-124
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000138
Family EGF-type module 0.012
Further Details:      
 
Domain Number 4 Region: 324-353
Classification Level Classification E-value
Superfamily Notch domain 0.00000157
Family Notch domain 0.0048
Further Details:      
 
Domain Number 5 Region: 282-313
Classification Level Classification E-value
Superfamily Notch domain 0.00000484
Family Notch domain 0.0013
Further Details:      
 
Domain Number 6 Region: 231-271
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000102
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A6C8Y6
Sequence length 1007
Comment (tr|A0A2A6C8Y6|A0A2A6C8Y6_PRIPA) Ankyrin repeat-containing protein {ECO:0000313|EMBL:PDM74538.1} KW=Complete proteome OX=54126 OS=Pristionchus pacificus (Parasitic nematode). GN=PRIPAC_41894 OC=Neodiplogasteridae; Pristionchus.
Sequence
MKSLFFLSIFTSFFTTTLGLIQGQCSPQACSDYGSCRQVNQSFYSCECLDPLHYGIRYEL
KKCPNGSSAEPCETTEKCDGPICPDDICSIDRPCLNEGTCTVTASGFNCTCLPGFTGERC
ETDDSPTFCSTDSCSNGYCLGLRCICDEGWAGANCSLDIDECADSPCAGGSTCLNKLGSF
ECLCPEGRYGLRCEAGSCKSDRECLNGGHCVDAECICQPNFEGPNCERPSHDPCSSAPCS
SERVCLRNQSELRGFSCVCPPGMRGRLCDLPIGSYHSQNSQCSLSFCPLFAGDNICHPEC
NNFACGFDGGDCSGGSVPFSRCPDAAFCALRFKDGKCDEQCNNENCLFDGFDCAGPEPAI
HKKGTMTDITLTVLVKPATFVKEVDNYLKLFADRLRTTVIVKKSEGAMEVFEWNSRDGVG
PRVDFGPRTDARVEVSTRLKRFVRKEEILNGIIVVVEVELDECDRGCFSDAYAVAQFIEM
MEAKEPLNPDMPIHSAVIARKKEKSGSSLLPVLLACLLLAVAVIVGTVVATNRKGTKRRN
IITAPEWMPPTKDAARSMNGYNTHQPVVEPTTKMLLPVYRVEPAPEQHEDASHLELAAMG
KERITPMMRALPTRHSATPLHLLALNCVKRSDEIMADVNLVLDSFEVDVNQQDEDGNTAL
HYACRNARPAMARRLLEAGADPSIDNELDRTPLHVAAQNCDDLCIEALLGHSFYKDKDTL
DVVDVEDRTALMYYAANSTHSIRGAELLLKAGADVNYAGDKKKMVSYRGRTALHHLALAN
QDNQGLVEFLVGRNANKDAQDTEDATPLFLATNGNNLMAVTALIKAGASLEYADQMGRTP
HELAVARGYLDVAERLRVAAVSSRRLGAPFSYVPTTTISAARSIKNATRRTLTSGSSNNT
TPSPLGLKASSSSGTSFLDSPHSDSHHSSEIGSPIYSNQPTAHQPAAALRPSPPYDNAYD
SVEFHSSFGQDPQTGQFQQYSSAYNQSACIHQSHHFLNHNPHYQNQQ
Download sequence
Identical sequences A0A2A6C8Y6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]