SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6MPB9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6MPB9
Domain Number 1 Region: 81-227
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 6.8e-16
Family GntR ligand-binding domain-like 0.018
Further Details:      
 
Domain Number 2 Region: 10-103
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 9.48e-16
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A6MPB9
Sequence length 252
Comment (tr|A0A2A6MPB9|A0A2A6MPB9_9BRAD) GntR family transcriptional regulator {ECO:0000313|EMBL:PDT56693.1} KW=Complete proteome OX=1355477 OS=Bradyrhizobium diazoefficiens. GN=CO678_36635 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MAEREVDRSVSQTVKAQLALRDQILSGSLRPGERISELQAVETTGASRTPVRMALVRLEE
EGLLEAIPSGGFMVKAFSERDISDSIELRGTLEGLAARFAAERGVSARELEPLKECSAAI
DELLRQVPISVDAFSSYVTLNARFHALLTELSRSPPLIRQIDRASALPFASPSGFVMAQS
ALPEAQQILIIGQEHHRVVIDAIENREGARAEAIMREHARLAVRNLRLALRNRTHLDLLP
ALALIKTATDQG
Download sequence
Identical sequences A0A2A6MPB9 Q89SK9
224911.blr2391 NP_769031.1.11505 WP_011085178.1.15658 WP_011085178.1.90507 gi|27377502|ref|NP_769031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]