SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A6MTQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A6MTQ8
Domain Number 1 Region: 135-269
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.6e-28
Family GntR ligand-binding domain-like 0.0093
Further Details:      
 
Domain Number 2 Region: 65-133
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.81e-17
Family GntR-like transcriptional regulators 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A6MTQ8
Sequence length 274
Comment (tr|A0A2A6MTQ8|A0A2A6MTQ8_9BRAD) GntR family transcriptional regulator {ECO:0000313|EMBL:PDT57889.1} KW=Complete proteome OX=1355477 OS=Bradyrhizobium diazoefficiens. GN=CO678_31130 OC=Bradyrhizobiaceae; Bradyrhizobium.
Sequence
MRRSWRHSARRRPRSTGPPLRTFVYKDIQKLRKPHLCMGRMRFLLRGCMSRRPAKAGSIA
RGAGVALGEAVFRSLCEALQAGSYRAGDRLREEEVAQRLKVSRTPVREALGRLAARGFVE
PAGGRGLIVRNLDISEVLELYAMREIMEGAAARLAAEHASATEIDALRDIEQTFVEASAT
DAIEMARLNRAFHEAICRAARNRYLDNASRELQDWIALLGPTTFTVTGRPTTSHGEHQAI
IDAIAARDGDRAEQLARAHIREALRCRLKLLQKQ
Download sequence
Identical sequences A0A2A6MTQ8 Q89ST1
NP_768959.1.11505 WP_011085107.1.15658 WP_011085107.1.90507 224911.bll2319 gi|27377430|ref|NP_768959.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]