SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A7ZWQ3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A7ZWQ3
Domain Number 1 Region: 1-151
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 7.85e-24
Family SMI1/KNR4-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2A7ZWQ3
Sequence length 165
Comment (tr|A0A2A7ZWQ3|A0A2A7ZWQ3_BACCE) SMI1/KNR4 family protein {ECO:0000313|EMBL:PEM05873.1} KW=Complete proteome OX=1396 OS=Bacillus cereus. GN=CN602_00405 OC=Bacillus cereus group.
Sequence
MENINQLIKKVKSLPNCRVQEPTELPIIDKNKHMLPDDLKEFYSLCGGLTLFENEEYSIQ
IITPEEFILANPVIVGELCEEDISSNWYIICNDGKDEYLTIDLSEERLGRCYDSFFDRHG
IVGETQIIATSFTDLLEKLIKNNGQYWYWLKSEFESLGDAYDDQE
Download sequence
Identical sequences A0A0D0QGC7 A0A0D0RB57 A0A243K654 A0A2A7ZWQ3 A0A2B3LGE1
WP_043936976.1.13279 WP_043936976.1.17797 WP_043936976.1.34125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]