SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2A9NGZ2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2A9NGZ2
Domain Number 1 Region: 234-322
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000313
Family Thioltransferase 0.043
Further Details:      
 
Domain Number 2 Region: 471-515,554-585
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000655
Family UBX domain 0.021
Further Details:      
 
Weak hits

Sequence:  A0A2A9NGZ2
Domain Number - Region: 6-46
Classification Level Classification E-value
Superfamily UBA-like 0.00765
Family TAP-C domain-like 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2A9NGZ2
Sequence length 622
Comment (tr|A0A2A9NGZ2|A0A2A9NGZ2_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:PFH48584.1} OX=703135 OS=Amanita thiersii Skay4041. GN=AMATHDRAFT_5669 OC=Agaricomycetes; Agaricomycetidae; Agaricales; Amanitaceae; Amanita.
Sequence
MDALNDDQRYALSQLRELTNGGDDDAAINILESVGWDVQQAANLIFGGATGEASAAGSST
PSSSRPKSRLESLELDDSRQGLLDSDDVTRGYQRQRAAPSTLFIIARPILSLLAVPIHIL
SSVIRFIFGLLRLPVPQFHLRFTGLNFYRPIRGPRARGLGHGSGPERWIQELEEETGAVC
IGRVKNSKPNGGGVGGGVTAASSAMDAGPSNLTARSAAVAGSPIDGLLEDGRKVLPDFSL
GTYEEMLRACKREAKIGCVILVSEEHDDVVEFKRSTLTDPTFVKMLYENNIVVWGGDVRD
REAWTAAEKLQATTYPFVAFLALQPRRSPPGSSNSSSNSSPTLTILSRHQGRSVPSSGPT
SASTLVAQLERNVLPRVMPFLDVLKAADRERQLERQLREEQDRAYREAARKDKERIEAMM
RKEREEAEQKRRQEEEREREQERKEALEREIRKKEEERMIWRRWMRRHMVGRTPTGEGEG
PLRMAIRLPNGTRLVRRFKADMSLTALYAFVDVQFIPAHLVEDDDPKSIPSASLDRSPES
CIETKITSLDNGVNDWWGFHIVNAYPRKEIEWAPGVKLSDVDCLKGGGQVVVELLGINNG
RHTQRGQTGIADDDDDGYDTEE
Download sequence
Identical sequences A0A2A9NGZ2
jgi|Amath1|5669|gm1.5669_g

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]