SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9JMW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9JMW6
Domain Number 1 Region: 55-420
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.81e-78
Family Ankyrin repeat 0.0000141
Further Details:      
 
Domain Number 2 Region: 508-556
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000209
Family SOCS box-like 0.0039
Further Details:      
 
Domain Number 3 Region: 397-484
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000932
Family Ankyrin repeat 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9JMW6
Sequence length 582
Comment (tr|A0A2C9JMW6|A0A2C9JMW6_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB005029-PB, ECO:0000313|VectorBase:BGLB005029-PD} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MMQDLSNMKHMLSSFKDMLKKENKFKTEMAAAGDSEDAQKEKMMEIFIKSMEGEHMSIID
SLLKTKLRDKRLPLDVNQCVIEASIRGNLVVLTKLLNLHPRLSHGDDENRRAIHYAAMNG
HLGCVKLLLKSGASSNCSDDDGRTPLHYACSNGHLDIVKTLVTQGSSVNSCRTEIGECAL
HVTAATDHVNIMEVLLDNGGDVNNMTRKLKGGSTPLHIAITSDKPDMVDYLCRHGALLNM
EDGFGKFPIHIACEKGVVRCIPVLIQHGADLEMLDSYNQTPLCSAALENQPAVAKLLIEH
GAIVHSVDNNGFTPLHKASIKGNVELIDHLMSAGADLNKRSTKSLQTPLMTAVYFGKLEA
IKRLVHYGADTTVTDINGQTPLHLVHSKIGGDPIDKILLALLEGGGRLDIRDQNHFTPLQ
KGIYTGVVRSNLSLPSIQLLVQAGSLLAPDKYTSGKNSPLFWLAYSGCLKEAAYLVRAGW
DLNNETWIMLPGKDSMQDKLHDFMIVNFRTVPSLLHRTRQVIRSHLSSIRKFREILSSID
SLPIPSALKSYLKLEDVDPNNMDFLDWEDAGPYDEDEDESDS
Download sequence
Identical sequences A0A2C9JMW6
XP_013073891.1.17457 XP_013073892.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]