SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9KYD8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9KYD8
Domain Number 1 Region: 18-277
Classification Level Classification E-value
Superfamily Ankyrin repeat 6.7e-48
Family Ankyrin repeat 0.00063
Further Details:      
 
Domain Number 2 Region: 338-385
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000327
Family SOCS box-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9KYD8
Sequence length 430
Comment (tr|A0A2C9KYD8|A0A2C9KYD8_BIOGL) Uncharacterized protein {ECO:0000313|VectorBase:BGLB024888-PA} KW=Complete proteome; Reference proteome OX=6526 OS=Biomphalaria glabrata (Bloodfluke planorb) (Freshwater snail). GN= OC=Planorbidae; Biomphalaria.
Sequence
MEKKLKSTNEKPSKIIEFFTAVQAGNCRKVRKMLKLKDVDINDTNPSECTNTTALIIACQ
LELFDMVDLLLKTKPKPPNVNSETTTGCRAIWWAVKHGNIQLTKLLLSTNKCEVNFTEKE
TGYTLLYRAILSNSPAIVKELLHAGADVNTKLHFDSGAVTPLIKAIQMNNLDICQLLINN
LCNLHAVIENGCTALHIAVVLRRYEICELLLESGSKVNAKSKAGVTAMTIAIEQHNPYMV
RLLLQYGYKMDRQYSWRETPLEQAIRLHSDKCAITLLLWGCKLSKKSRPSYLYMAVSEKL
WNVVHFLVELNPMCLQETWLKKKQWPVAVYCDEALRQHILELSTQVFSLKELCRSKVFRC
IGRFAPVKLVELPLPAPLIDYMMFREFIKEDFYDKIALEKIICPYDCPVICSQWDCYPLD
ISVSSDSEEY
Download sequence
Identical sequences A0A2C9KYD8
XP_013070035.1.17457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]