SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9U4E6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9U4E6
Domain Number 1 Region: 53-248
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.08e-40
Family PAPS reductase-like 0.0041
Further Details:      
 
Domain Number 2 Region: 320-429
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.36e-20
Family PDI-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9U4E6
Sequence length 432
Comment (tr|A0A2C9U4E6|A0A2C9U4E6_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY24577.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_17G026200 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MRLWDRPAIVSLSQRGCALKPVNAEFKWNDSIVPLAAAIVEPEVAVKIEVENYEQLAEEL
QNSSPLEIMDKAFEKFGNDIAIAFSGAEDVALIEYAKLTGRPFRVFSLDTGRLNPETYRF
FDAVEKHYGIHIEYMFPDAVEVQAMVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLRA
WITGQRKDQSPGTRSGIPVVQVDPVFEGMDGGVGSLIKWNPMANVEGLNAWNFLGAMNVP
VNSLHSQGYVSIGCEPCTRPILPGQHEREGRWWWEDAKAKECGLHKGNLKQDDLAQLNGN
GNGAIHSNGAAGVADIFNSQNLVNLSSAGIGNLLRLESRKEPWIVVLYAPWCQFCQGMEK
SYLELADKLAGSGVRVGKFRADGDGKEFAKQELQLGSFPTILFFPKHSSRPIKYPSEKRD
VDSLMAFVNALR
Download sequence
Identical sequences A0A2C9U4E6
cassava4.1_008016m|PACid:17968856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]