SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2C9UPN3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2C9UPN3
Domain Number 1 Region: 342-375
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000745
Family Rho termination factor, N-terminal domain 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2C9UPN3
Sequence length 382
Comment (tr|A0A2C9UPN3|A0A2C9UPN3_MANES) Uncharacterized protein {ECO:0000313|EMBL:OAY32647.1} OX=3983 OS=Manihot esculenta (Cassava) (Jatropha manihot). GN=MANES_13G034800 OC=Crotonoideae; Manihoteae; Manihot.
Sequence
MSQAVHLIAKNLPGCGPSEGWYLPCSGISGKAVAVSHSFSHGSHRIHSHIKFGSIKCAAG
ASSFVCRASSGGPRRNSDFSKQSKQGFSRNRNRPNEERDSFENLDESDLLSSKNGPLLSF
SNTPKFQSTAAPGPREKEIVELFRKVQARLRERAAVKEEKKVETSKGKGKESETVDSLLK
LLRKHSIEQGKKKVSSQDFAVDQQEQRGSHSEGKSKVFLNRNNKERSGVLEPNSSSFTRP
PSNFRRKSPVPRGKFQPVYSNEDPANSTPYLNLNGEEKKKLEEIPDAVQQTELEAEEAEL
ELEQEPESSFPNGDVFNELSEEESSNIIDAEADSDIQEEIEHEDLSSLKLPELRAIAKSR
GVKGFSKMKKSELVELLSGGVV
Download sequence
Identical sequences A0A2C9UPN3
cassava4.1_009622m|PACid:17968373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]