SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D0QEU6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0QEU6
Domain Number 1 Region: 152-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000772
Family LDL receptor-like module 0.0013
Further Details:      
 
Domain Number 2 Region: 606-648
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000196
Family TSP-1 type 1 repeat 0.0015
Further Details:      
 
Domain Number 3 Region: 552-593
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000441
Family EGF-type module 0.016
Further Details:      
 
Domain Number 4 Region: 93-140
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000876
Family TSP-1 type 1 repeat 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2D0QEU6
Sequence length 648
Comment (tr|A0A2D0QEU6|A0A2D0QEU6_ICTPU) complement component C9 {ECO:0000313|RefSeq:XP_017315885.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=c9 OC=Ictaluridae; Ictalurus.
Sequence
MGYSRSTYQCDYQVSTYFWPYSVGGWKTRCTKDPPHTNRHQSTSPGRSLTMRMLMLTALF
TYCFLQLTAGMSVGDFMQGSKREAREVREPIRIDCKMTAWTMWAPCDPCTKTMHRSRGIE
IFGQFGGQRCIQPIGEKKPCKPTTQCVEDPLPVCSTNEFLCESGFCIKRRLVCNGDNDCD
DSTDEDECNKIRSPCGNVAVSESDIGLDAGYGINILGTGPRMNPFNNKVYNGICDRVKEP
STLSYNRLPWNVAVINYETLVEETTSKEVYKDTHSLLSEITQDITSQTSIGLSFKFTPTD
SSAQNNLTQPVSVTAGFDSGTEKREMIKTMTDHSTTKEKSFFRVKGKVQLGTYRMRSRGL
EVSQLFLDDVDALPLEYEKGQYFGFLEDYGTHYTKNGRVGGEYELVYVLNNKAITDKKKT
ESLLKDCLKIGINLNFQLTEGEVQPGTSNSDKCTELKHDYTVADESEPLIDKVISAVKGG
SPKSAAAMKSGLSKDVVLNWSHYVEWAATLSDLPALIHSDPEPIYNAIPLNFPDAQPRRE
NLQRALNEYMAEYSVCKCQPCQNGGTVAQVDGNCICLCPLHFEGLACQTIRHELIKDKDQ
PIEQLGNWGCWSSWSSCSGGRQSRTRSCKTGGIAGVTCKGDTVSEEYC
Download sequence
Identical sequences A0A2D0QEU6
XP_017315885.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]