SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D0SXA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D0SXA1
Domain Number 1 Region: 21-33,60-164
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0000000445
Family Pseudo ankyrin repeat 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D0SXA1
Sequence length 914
Comment (tr|A0A2D0SXA1|A0A2D0SXA1_ICTPU) short transient receptor potential channel 2-like {ECO:0000313|RefSeq:XP_017347309.1} KW=Complete proteome; Reference proteome OX=7998 OS=Ictalurus punctatus (Channel catfish) (Silurus punctatus). GN=LOC108278440 OC=Ictaluridae; Ictalurus.
Sequence
MELLTPVQWREIVNKKMLFPPELISAIHEGNVAGIRSLLKTGDGIIRQLEESEDRQWREA
LNLSIRLGNEDTMVTLLHGVKFDFRQIHEALLVAVDTNQPRIVKRLLDRLDQEKGNKMDV
HSFNQAIFDHSIDDSQFAPGVTPLTLACQKDRYDIVTMLTQKGHVIPWPHKVSCSCLECR
NGRQYDLLKFSLSRINTYRGLASRAYLSVTTEDAMLSAFYLSRDLRKLSKREPEFKPQYL
ALEELCQEFAVELLGMCRNQSEVTTILNDCGIKDADSQEELEKHSFEEGIPNLARLRLAV
NYNQKQFVAHPICQQVLSSIWAGNLSGWRGSRTAWKLLVSVGIFVTMPILCLIYWIAPKS
KVGKILKIPAIKFILHSASYLWFLIILLAESIIMEMFRDASSTRNQTILQNSIHMVWVAG
FFWYECKEVWIEGLRSYFLDLWNCLDVIVLSMYLASFALRVVVLVKGYIVCQQPESAECF
YFTQSARQDWLQEDPQIIAELLFAVTSMLSFTRLAYILPAQESLGTLQISMGKMIDDMMR
FLFILMIIGTAFLCGINNIYVSYAESQYLGRFNETFQFLFWTMFGVVNKEYVDMPEHDLA
QFVGRILYGIFTLLIVIVLLNMFIAMITNSYQKIEDDADVEWKFARSKLYLSYFREGLTM
PVPFNIIPSPKAFFYLIRKLCCWCNFNSAPDYPPIGSVSNETDEKVSYRNQVIRALVQRY
IDSARREFEETKRKDIGNRVTELNKVVGHLHGEMKQIHQTLIDMGENRLDPSERSTSSII
GKYIQGAKNNFRDFNSVVPSESKSVPLLANIHQMKSEDEGDVNGEELNGTEETFDKGKIE
EEGAGDETMEQEGKDQTGDGADESNDQSAVEDETTKMEEGRADAGIEEPLTGSSGSQDTG
FGSEESELSASSPE
Download sequence
Identical sequences A0A2D0SXA1
XP_017347309.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]