SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D1AHE1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D1AHE1
Domain Number 1 Region: 25-128
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 1.31e-32
Family Chemosensory protein Csp2 0.0000988
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D1AHE1
Sequence length 129
Comment (tr|A0A2D1AHE1|A0A2D1AHE1_9ORTH) Chemosensory protein 2 {ECO:0000313|EMBL:ATI99841.1} OX=244712 OS=Oedaleus asiaticus. GN=CSP2 OC=Acridomorpha; Acridoidea; Acrididae; Oedipodinae; Oedaleus.
Sequence
MAGKLTVCCLLGLLALCVEAAPQDPLDSFNVDEVLSNERLLKSYIQCMLDDGEGRCTKEG
KEIKKRLPQFVATGCLECTPSQLDRAIKTLKHVTEEHAEDWARLKAKYDPTGEYSRKHAD
TWKQRGINF
Download sequence
Identical sequences A0A2D1AHE1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]