SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4BNS1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4BNS1
Domain Number 1 Region: 55-243
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.19e-47
Family PAPS reductase-like 0.0000266
Further Details:      
 
Domain Number 2 Region: 309-386
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.34e-17
Family Thioltransferase 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4BNS1
Sequence length 396
Comment (tr|A0A2D4BNS1|A0A2D4BNS1_PYTIN) Phosphoadenosine phosphosulfate reductase {ECO:0000313|EMBL:GAX95832.1} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_003695 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MAPKTTPSISTDCDDNQQGQAESLPVTAAAARAAALPRNALYEEQLYDSLESFVEQMNAQ
LATKSASEIVQWTVDTFGAQHTVLSSSFGIQSAVMLNLVRAVDRHVPVVWIDTGYLPQET
YQFAARLTKDLDXNVHVYQSPITPARMEALYGKLWEIPTVEAHKQYGYIRKVEPMQRALR
ELRAKALLVGVRADQTSHRETMKIVNIYEGRLKICPILKWTKDDVDAYMATHALPYHPLK
AQGYETVGDAHSSRPVTAEDGENVRASRFXGVAQECGLHLDMQNMSLDSVLRAAEDPALA
LSDYEEKLLAKTQQSKGIVVFSKPSCKYCLAAKDVFRERDWEYEDFTVGADISIQALQQI
VGQPVKTVPQIFIDGXYVGGYTELCASLNIPSRFAS
Download sequence
Identical sequences A0A2D4BNS1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]