SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4BY54 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4BY54
Domain Number 1 Region: 332-465
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.27e-26
Family Chaperone J-domain 0.00014
Further Details:      
 
Domain Number 2 Region: 16-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000114
Family DIX domain 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4BY54
Sequence length 469
Comment (tr|A0A2D4BY54|A0A2D4BY54_PYTIN) Uncharacterized protein {ECO:0000313|EMBL:GAX98309.1} KW=Complete proteome OX=114742 OS=Pythium insidiosum (Pythiosis disease agent). GN=PINS_006194 OC=Eukaryota; Stramenopiles; Oomycetes; Pythiales; Pythiaceae; Pythium.
Sequence
MTAATSAAPAGGIWAFYYIQGEDGEDRSHPNAFKIPAPSGGGDVTLADVHRHFPLKDASA
FHFRFRINTSIKTANGPTSTFFWLDITSPAQKVPLVNGRVICKLLRLVRPQRVGLLFKRR
PVLKWSSDATAGGRNGSNEAAARHGASQPSMQRQASGGYDKGRPAKYSDSPSGTPPPERN
GSERSASGGSGSGSRSGSGSLPKAAAPPAPQESFEDFLSGGQSTPAKSADVNLMSDSSWS
ASGAAAPQKNAASDFLSSMDPLAQPAGNGGSKSAAPARAPVRTEQPKFEDDGGQTVGPVT
MDEMQKYAVSADGSNVYNPRLVDKSTKPEHVRRAMEERERQVQMEVEKAREELRRREEAK
NQMNAMKENASAVLGPKLKQWAEDNGRVKNIRTLLSTMHTVMWEDCKWTEVNMGKLIQPN
DIKKHYRKAMIVVHPDKSPGRSAEQLLIAERVFAALNTAWDEFMKTNPC
Download sequence
Identical sequences A0A2D4BY54

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]