SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4NA15 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4NA15
Domain Number 1 Region: 24-187
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.96e-38
Family CRAL/TRIO domain 0.0029
Further Details:      
 
Domain Number 2 Region: 254-392
Classification Level Classification E-value
Superfamily PapD-like 1.28e-37
Family MSP-like 0.00000112
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2D4NA15
Sequence length 453
Comment (tr|A0A2D4NA15|A0A2D4NA15_9SAUR) Uncharacterized protein {ECO:0000313|EMBL:LAB41823.1} OX=129469 OS=Micrurus spixii (Amazon coral snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MIDESFQWRKEYAVHDLTESSFPKLMFDVGAIYLHGYDKEGYKIFWFRVKLHTKDSKTQF
EKKKLVAFWLERYAKRENGKPLTVVFDMADTGLSNIDFDFVRYIISCFKVYYPNFLTKIV
IFELPWVMNAAFKIVKNWLGPEAAALLKLTNKNEIQEYITAEYLPPYMGGTDAFKYSYPP
LVDDDFQTPLCENGPITSEDEAECKEVDTNNKDNTDTTEEQALNSKKANTSEQTPKSEVC
DKLDSKTKNAKKALTTFKGSLLHISPAEELHFGSKETAEKKCLIVLTNVTKNAVAFKVRT
TAPDKYRVKPSNSSFEPGTSVDIVVSLHGGCAASLQDRFLIMAAEMEQCSGIGAQELSQF
WKDIPRNKVMEHRLRCHVVESSKPSSLIINENAFNSPSKTNEDLHFQLRQLLQANKRLQE
QIDRCVWFQQLTLFLVFILVTIVCFFLLCAPGS
Download sequence
Identical sequences A0A2D4NA15

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]