SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2D4Q4Q6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2D4Q4Q6
Domain Number 1 Region: 195-244
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000000968
Family SOCS box-like 0.0036
Further Details:      
 
Domain Number 2 Region: 2-107
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000348
Family Ankyrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2D4Q4Q6
Sequence length 279
Comment (tr|A0A2D4Q4Q6|A0A2D4Q4Q6_MICSU) Uncharacterized protein {ECO:0000313|EMBL:LAB65202.1} OX=129470 OS=Micrurus surinamensis (Surinam coral snake). GN= OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Micrurus.
Sequence
MGHSNILRMLIPVTDRVCGSAEGKVSPVYSAIYSGQEICLELLLKEGYSPDAQSCPVFGC
KSPMYLAFQKGSEIILILLKYGIKIFEIDLGLCLLHRRYNLFRHFLRKDCKLPCQLHLVE
FSKCAVSAGRDYREWLPSLLLAGFNPMNLLFHDWIFSVSSDALNFVLEFTNWKRLPWNVE
QVLSSHKATSMWMPCSYFEHIPSLSHLCRLEIRSLLTSVCLQSDQHIRQLPIPTCLQDFL
LYLDVLRTYSISESWLKADVYEESTLPSCSNSKYNEENK
Download sequence
Identical sequences A0A2D4Q4Q6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]