SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E1VRR3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E1VRR3
Domain Number 1 Region: 165-222
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.00000000589
Family Carboxypeptidase regulatory domain 0.026
Further Details:      
 
Domain Number 2 Region: 258-330
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.000000177
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2E1VRR3
Sequence length 344
Comment (tr|A0A2E1VRR3|A0A2E1VRR3_9BACT) Uncharacterized protein {ECO:0000313|EMBL:MAW60456.1} OX=2026780 OS=Planctomycetes bacterium. GN=CMJ94_06445 OC=Bacteria; Planctomycetes.
Sequence
MQPHPTRGSSAVLLLLGAALLLALGWILFQPSAPVEPLDDGTTPAVSAADGPSEAQVEST
PVAETQRSSLLVKAQLTVILSKPGWATLPESVEVELIPQGDTPGEAQLERTRQGGALVEF
YDLLFGSYLIRVRALGFATAEVPVQISKEAAAQRQVVALLPAREITGEVRDASGRPVAGI
EVSARPIENIPGFVQSTGTTRTDEQGRYHLTPLPEGRFYVHVGPLLHPINDPVEVELYGE
RVFQDLRVGPLAGVSFEIVDASSEAAIAGARAQIQRISEDGQRGHAQYRSADSQGRIAFE
HIPPGEYTVTVLASQYRTSTGTYRIHEGADGQVRIALIPLSRES
Download sequence
Identical sequences A0A2E1VRR3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]