SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E2NQY9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E2NQY9
Domain Number 1 Region: 404-551
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000522
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 646-792
Classification Level Classification E-value
Superfamily ARM repeat 0.00000000015
Family PBS lyase HEAT-like repeat 0.029
Further Details:      
 
Domain Number 3 Region: 159-240
Classification Level Classification E-value
Superfamily TPR-like 0.000000911
Family Tetratricopeptide repeat (TPR) 0.07
Further Details:      
 
Domain Number 4 Region: 38-156
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000115
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2E2NQY9
Sequence length 994
Comment (tr|A0A2E2NQY9|A0A2E2NQY9_9DELT) Uncharacterized protein {ECO:0000313|EMBL:MAY80754.1} OX=2026735 OS=Deltaproteobacteria bacterium. GN=CL930_08205 OC=Bacteria; Proteobacteria; Deltaproteobacteria.
Sequence
MSSLVCLDAPQRSGASSLIQSCSMQTAVDPFQPLLSVIDRYRNDVHNLRAPATEEALAQA
EQHLTAPIPKSMLRFLHRWNGAVLFRGVLRIRSVSDLAPAAQHTPSIVVFADGPTETDHW
AYTPDEQGDAIFGRWTGTHFEALHDRFEAWLASTIHILDNNIREPQQQLDARLEVDPGSG
FLLMKRAEQILANGDAAGATEILKRATAAHPGLVGAWERLGHALIEEDPSQARWAFLKAL
RGIRFPSQIPTNHGATPAIIQALGTLFPKGDDAWERELVHFLSEGTADVHGYDELAMVEQ
AGVALAQVHLERHDRNAAHGILVDLLERARGFQVRGPMQEAVLLLARIEVDLGHHDDAER
RLRTLRYDPRPVSDRARLLIGTIAASRQEPWCEDTLEECTTSLVNPADRCEAMLLLGERL
LLREQHERASALFLEVTEIASGINNDQLQSRAILGAGDVQRSKGDFNSAASSYQEARQLA
GSNPELLQRVLIRRGDLFRAKGDHETALQDYSRAADTYASLGLPIREAWARLRMAQLGSE
GAAEKAHQLFKSVDHAAGVAAADAISGMPARSLDWHLNRAADHARDRANAQRARPPLTRA
DAERPERRIGAHRMAIAACSLRVVEHLATELDTLSKTLDLSSPRGTDPNLARFIAAADLL
SSHRSYEAAEVLLRHLLTVRVGGSAKLALIGAMARSPNAALVDGLLEALEGGHDPNGTAA
AADVLGLRREPVALDALKRLAAPGSNPTIRKAAITALGRIGDISAIDHLLPALDEPDLAE
ETSIALLLLGEWQGVDYQAQALASPRPGMSRSLGEIVGRYGGPNYLLLLFRSADIEGAAG
LGALQGLGYLGDPRAVPRLIEATASREQSKARVASGALELLTGHHEDPEESLLRNRWTQW
WDEHSQHFEEGYRYRHGRLMDPGLLLDRMSHDDPMVRRSTYDELVIASGQRLPFDAEGPY
RVQLQHISEWRTWWAENQGRFPTGRWTFHGEQVG
Download sequence
Identical sequences A0A2E2NQY9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]