SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E4V8E7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E4V8E7
Domain Number 1 Region: 44-176
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000634
Family EF1021-like 0.031
Further Details:      
 
Domain Number 2 Region: 220-289
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000863
Family SMI1/KNR4-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2E4V8E7
Sequence length 317
Comment (tr|A0A2E4V8E7|A0A2E4V8E7_9BACT) Uncharacterized protein {ECO:0000313|EMBL:MBF72832.1} OX=2026781 OS=Candidatus Poribacteria bacterium. GN=CMK20_01425 OC=Bacteria; Candidatus Poribacteria.
Sequence
MYKKLGEXNLKSGELMEVGVVITPDIDYSNELGEFLGHKPDHYKWHIDQCLQKTLDQLET
RFYIGKLNXQIISNIMTTEFEGIGILGHVFTLPDQRRKGACKGIMTYQMQDFASRXGRML
YLGTGYDSAPYWIYHYFGFRSVYPKSGFMKYSAHIDSETKHFXFSESNVKKVEWNDWSHL
TALTGIVDGTXFRSTIYDIKGPTNFESGFLRLKQNLQIKPDHYKSLLLKTGNGAIVAFAN
LDVSNNKKAYLDLFSHPSFWSQTPRXITEMEFPPDARVICETGYEDYERIAVLEQINFKQ
KSXYETXDGRQILIFEN
Download sequence
Identical sequences A0A2E4V8E7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]