SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2E8RLA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2E8RLA9
Domain Number 1 Region: 37-176
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000000000788
Family EF1021-like 0.043
Further Details:      
 
Domain Number 2 Region: 220-290
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000536
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2E8RLA9
Sequence length 317
Comment (tr|A0A2E8RLA9|A0A2E8RLA9_9BACT) Uncharacterized protein {ECO:0000313|EMBL:MBR53473.1} OX=2026781 OS=Candidatus Poribacteria bacterium. GN=CMK19_06860 OC=Bacteria; Candidatus Poribacteria.
Sequence
MYKKLGETTLKSGELMEVGVVTTPDLDYADELGEFLGHKPDHYKWHIDQCLQKTLDQLET
RFYIGKLNGQIISNIMTTEFEGIGILGHVFTLPDQRRKGACKGIMTYQMEDFVSRSGRML
YLGTGYDSAPYWIYHYFGFRSVYPESGFMKYSAHIDSETKHFFFSESNVKKVEWKDWSNL
TALMGIVDGTYFRSTIYDIKGPTNFESGFLRLKHNLQIKPNHYKSLLLKTGNGAIVAFAH
LDVSNNEKAYLDLFSHPSFWSQTPKLITEMEFPPDARVICETGYEDYERIAVLEQTDFKQ
RSHYETEDGRQILIFEN
Download sequence
Identical sequences A0A2E8RLA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]