SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2F0AWF6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2F0AWF6
Domain Number 1 Region: 31-144
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.14e-28
Family Spermadhesin, CUB domain 0.00052
Further Details:      
 
Domain Number 2 Region: 239-353
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.000000000000327
Family Spermadhesin, CUB domain 0.0036
Further Details:      
 
Domain Number 3 Region: 442-479
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000000563
Family LDL receptor-like module 0.00085
Further Details:      
 
Domain Number 4 Region: 152-189
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000017
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 5 Region: 198-237
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000118
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 6 Region: 403-440
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000471
Family LDL receptor-like module 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2F0AWF6
Sequence length 757
Comment (tr|A0A2F0AWF6|A0A2F0AWF6_ESCRO) Low-density lipoprotein receptor-related protein 3 {ECO:0000313|EMBL:MBV95095.1} OX=9764 OS=Eschrichtius robustus (California gray whale) (Eschrichtius gibbosus). GN=ESR_14549 OC=Mysticeti; Eschrichtiidae; Eschrichtius.
Sequence
MGGSSVPLPHYPLPPKGEASISQPPLLTAACSGKLEQHTERRGVIYSPAWPLNYPPGTNC
SWYIQGDRGDMITISFRNFDVEESHQCSLDWLMLGPAAPPRQEAFRLCGSAIPPAFISAR
DHVWIFFHSDASSSGQAQGFRLSYIRGKLGQASCQADEFRCDNGKCLPGPWQCNTVDECG
DGSDEGNCSAPASEPPGSLCPGGTFPCSGARSTRCLPAERRCDGTQDCGDGSDEAGCPDL
ACGRRLGSFYGSFASPDLFGAARGPSDLHCTWLVDTQDPRRVLLQLELRLGYDDYVQVYE
GLGERGDRLLQTLSYRSNHRPVSLEAAQGRLTVAYHARARSAGHGFNATYQVKGYCLPWE
QPCGSSREGDVEDTGEQGCFSEPQRCDGWWHCASGRDEQGCPACPPDQYPCEGGSGLCYT
PADRCNNQKSCPNGADEKNCFSCQPGTFHCGTNLCIFETWRCDGQEDCQDGSDEHGCLAA
VPRKVITAALIGSLVCGLLLVIALGCAFKLYSLRTQEYRAFETQMTRLEAEFVRREAPPS
YGQLIAQGLIPPVEDFPVYSASQASVLQNLRTAMRRQMRRHASRRGPSRRRLGRLWNRLF
HRPRAPRGQIPLLTAACTSQTVLGDGLLQPAPGAGLDPPAPLTDTGSPGAAGEGPPGAPS
HAPEVGPSAPPPSGLRDPEARPVHKDRKAGRDPLVDNPAPVDMPRESCLALGPHPPAPTA
GSTLGPHPPEPLGVCRSPPPPCSPTLEASDDEALLVC
Download sequence
Identical sequences A0A2F0AWF6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]