SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G1LCK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G1LCK5
Domain Number 1 Region: 161-340
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-46
Family Glutathione peroxidase-like 0.0007
Further Details:      
 
Domain Number 2 Region: 50-162
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.98e-19
Family FAD-linked reductases, N-terminal domain 0.0002
Further Details:      
 
Domain Number 3 Region: 5-39
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.000000432
Family PHBH-like 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G1LCK5
Sequence length 341
Comment (tr|A0A2G1LCK5|A0A2G1LCK5_9MICO) Phenol 2-monooxygenase {ECO:0000313|EMBL:PHP14231.1} KW=Complete proteome OX=57043 OS=Microbacterium esteraromaticum. GN=B4U78_10020 OC=Microbacterium.
Sequence
RVRQTPIETVIRKANEILHPYSIDVKDIAWHSVYEVGHRVTDGFDDVIDGSGRTPRVFLT
GDACHTHSAKAGQGMNVSMQDGFNLGWKLGSVLTGRSPETLLATYGAERKPVAQQLIDFD
REWSSLMARKPEEISDPQELATFYLGTAEFPSGFMTQYTSSMITGTDAHQALAAGFPLGK
RFKSAEVTRVCDGNVIHLGHHARADGRWRVYAFGDASGERLNAWAAQAAPVFARFTPADA
DVDSVFDVKAIHQGSYEDVEVTTVPELFAPKTGPLNLTDWEKVYASAPSKWNDTDIFEAR
ELSRDGVVVVVRPDQYVAAILPLDAVDELASFFEGALLPAS
Download sequence
Identical sequences A0A2G1LCK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]