SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G2VZ69 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G2VZ69
Domain Number 1 Region: 22-127
Classification Level Classification E-value
Superfamily Chaperone J-domain 3.01e-30
Family Chaperone J-domain 0.0003
Further Details:      
 
Domain Number 2 Region: 196-306
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000107
Family Calsequestrin 0.031
Further Details:      
 
Domain Number 3 Region: 439-564
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000224
Family PDI-like 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G2VZ69
Sequence length 573
Comment (tr|A0A2G2VZ69|A0A2G2VZ69_CAPBA) DnaJ protein ERDJ3A {ECO:0000313|EMBL:PHT38239.1} KW=Complete proteome; Reference proteome OX=33114 OS=Capsicum baccatum (Peruvian pepper). GN=CQW23_21812 OC=Capsiceae; Capsicum.
Sequence
MKTRRIPIGIVLCASLFVLHIQSKTVDPYKVLRVDKNASQREIQKAFHKLSLQYHPDKNK
NKGAQERFAEINNAYEILSDEDKRRNYDLYGDEKGAPGFDTGGAGDHGGYTYFTSAGPGQ
SGFNFGPGGMGGQGGAKSFSFSFGGPGSQSSSGFGLDDIFFNMFGGGMGSGSQFGVFGGF
GGSGRSQSRSKNSGKSIPSINSQMYKKETSDKGMTWLLLSHTSTSRGIQYYESVIEVASS
LDGAMKVGSINCETDASFCKSLGIYPRNAPRLFVYSLKPSGNGALVEYTDDFDVKRLKRF
CHEHLPRFSKRVDLDHFDFVSQTIGGLPKVMLLSTKEDTPVIWRALSGLYRNRFVFYDAQ
VRDVSDHAVRRLGVDALPAIVGWLSNGEKQIFRTGISVKNLKSAIQDLSGLLDSFEKKSK
KAASAQSKREQSEPEAKQIPVLIGSNFNDICGEKTPVCVIGVFRSSKARDKLEKVLLSVS
QKSLSRRQYIAYGSRDSVSYALLDAARQQSILNAFDKSGYKSSEKVLLAYKPRKGKFAVF
EGEVTAEDVEGFISSVLSGDVQFSNTRHNPIAK
Download sequence
Identical sequences A0A2G2VZ69

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]