SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G3CKJ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G3CKJ0
Domain Number 1 Region: 30-126
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.24e-19
Family PAPS reductase-like 0.0048
Further Details:      
 
Domain Number 2 Region: 198-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000131
Family PDI-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G3CKJ0
Sequence length 318
Comment (tr|A0A2G3CKJ0|A0A2G3CKJ0_CAPCH) 5'-adenylylsulfate reductase 1, chloroplastic {ECO:0000313|EMBL:PHU19242.1} KW=Complete proteome; Reference proteome OX=80379 OS=Capsicum chinense (Scotch bonnet) (Bonnet pepper). GN=BC332_10393 OC=Capsiceae; Capsicum.
Sequence
MISLFCCGAEDVALLKYAHLTGRPFKVFSLGFIEDDHQECCRIRKVRSLKRALKVLRAWI
TGQRKDQSAGTRSEIPIVQIDPSFEGLDGGACSLVKLNPVANVDGKDIWNFLQAMNVPVN
SLHSQGYVTIGYGGAAVSDIFDTKDIASLEAMEGSYIELVEKLANAAVKTANSRADDSLL
AFVNALSASVSDIFDIQDIVSLSRPGIENLLKLENRREPWLLVLYAPWCLFCQAMEGSYV
ELAEKLASYGVKVAKNKDRWSIANEAKLVDEKIKSFYIPPRPFSSSFGSNFRNGKVDGET
VLIGSGKVEVNDGALGRH
Download sequence
Identical sequences A0A2G3CKJ0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]