SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G4STV7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G4STV7
Domain Number 1 Region: 47-128
Classification Level Classification E-value
Superfamily Duffy binding domain-like 0.00000719
Family Duffy binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G4STV7
Sequence length 239
Comment (tr|A0A2G4STV7|A0A2G4STV7_9FUNG) Uncharacterized protein {ECO:0000313|EMBL:PHZ12191.1} OX=1340429 OS=Rhizopus microsporus ATCC 52813. GN=RHIMIDRAFT_251967 OC=Rhizopodaceae; Rhizopus.
Sequence
MSNENEKSLNLKGSTWPPDYSQYKDLSDDALDQIVENEAQNTQAPEAYKVLFGRLLTYCR
SITESNNRYQQQIHQLNTKCENYLRYIEAARENFENVSELYKEEHIRVLNLREDKLELRL
QIETYKNELKQAAQQLSETQKAREEVIQEHERYKELAGRNAEKQGLGRKNLEETLVEKEQ
QVEELQKAVAQLQNLLSLKEVEIRELNTRNKAISIVLEGTRHLQQQQQQQQQQNHLNFS
Download sequence
Identical sequences A0A1X0RHL6 A0A2G4STV7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]