SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5DF57 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DF57
Domain Number 1 Region: 221-254
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000239
Family Rho termination factor, N-terminal domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DF57
Sequence length 258
Comment (tr|A0A2G5DF57|A0A2G5DF57_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA42123.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_02100170v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MNATGLGFLSFPSQGLSSFTTHFSKSSNLGLSFIFPRKEITDNAPCLTFRPVRPTVWSIR
CEGNRIGRRRRSTASEGIQKGNIPESSDSESSKSAGQEDIIALFRQIQFSIAKDGGSTKI
RKRRSNNHKERKTAESVLDVLRQSRKQIQEENKVVPKRHGVPNTKGETKDSSLPTDFMLT
RPPSKFVKKSPIRRPSTLEEDVDEVVSEESEAAIVSEEPQLHKIEEMKVSELKELAKSRG
IKGYSKLKKGELVELLKG
Download sequence
Identical sequences A0A2G5DF57
Aquca_021_00170.1|PACid:22039519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]