SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5DVI8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5DVI8
Domain Number 1 Region: 7-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 9.61e-20
Family B3 DNA binding domain 0.0024
Further Details:      
 
Domain Number 2 Region: 163-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.35e-16
Family B3 DNA binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5DVI8
Sequence length 272
Comment (tr|A0A2G5DVI8|A0A2G5DVI8_AQUCA) Uncharacterized protein {ECO:0000313|EMBL:PIA47521.1} OX=218851 OS=Aquilegia coerulea (Rocky mountain columbine). GN=AQUCO_01400275v1 OC=Ranunculaceae; Thalictroideae; Aquilegia.
Sequence
MAKKITIQPNNPHFFKFIKCDSLQGISIPRAFVKDYLVGEKCEGKKARLRTKKSKKSWIV
STKGCCFTDGWENFHNENDLHAGDFLLFEHKGGFTFDVLVFDDSMCEKAYPPLDGDAKDD
EIVMEIDKPTKKRKYQNKKLAQIFSSSNLKNTAKVKNPLQLIVEMKPSHFKWRTFHVSAP
FGRESGLVRIAKLAKDTNKSYMITIKDPNGKSWKLRLNYKPSANVACFGSGWPEFRKANK
LKVGDVCTFMVVSMTSQKILLEMSVCKCKASF
Download sequence
Identical sequences A0A2G5DVI8
Aquca_014_00275.1|PACid:22027716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]