SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5UT03 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5UT03
Domain Number 1 Region: 58-109
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000314
Family TSP-1 type 1 repeat 0.0035
Further Details:      
 
Domain Number 2 Region: 29-59
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000107
Family Somatomedin B domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2G5UT03
Sequence length 255
Comment (tr|A0A2G5UT03|A0A2G5UT03_9PELO) Uncharacterized protein {ECO:0000313|EMBL:PIC42658.1} KW=Complete proteome OX=1611254 OS=Caenorhabditis nigoni. GN=B9Z55_009663 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MPLKVTSSPLLYEESRVQPVNDNLYYLESSISECYCDEHCVTLGDCCSDYTFVCPPKDCV
LTDWDQWTQCKADNGTCGIGTQKRLRHVIQHAERGGAACPPLKEMKTCFIDCKPKKSALD
DITTVALILDYKYNQTRAKTGRNNIYWDLPNIADKVKKASFYCVHYSIEWVNRNCVSRLL
NKGLTEGSVMCAECQPEATYHRNTGRCASDLDDGDQGFWKLIGPQSCNGIWTRINRTDSC
QCQVQYPQNHPFLLV
Download sequence
Identical sequences A0A2G5UT03

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]