SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G5UUF1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G5UUF1
Domain Number 1 Region: 4-99
Classification Level Classification E-value
Superfamily PapD-like 2.2e-22
Family MSP-like 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2G5UUF1
Sequence length 115
Comment (tr|A0A2G5UUF1|A0A2G5UUF1_9PELO) Uncharacterized protein {ECO:0000313|EMBL:PIC43150.1} KW=Complete proteome OX=1611254 OS=Caenorhabditis nigoni. GN=B9Z55_003975 OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MGVEVSLDPPVCPIQANGGTSKHKMINHTDRHLAYKVKSSNNSNYSVNLIYGILKVCDVK
ELIITRKPGKPQADKLIIQYCQVNDENADPKPLFANGVPPGELSGETIIKLSAAE
Download sequence
Identical sequences A0A2G5UUF1 G0N3Q0
CBN13312 CBN21268 135651.CBN13312 135651.CBN21268

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]