SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2G8I441 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2G8I441
Domain Number 1 Region: 10-137
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.0000000000131
Family SMI1/KNR4-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2G8I441
Sequence length 138
Comment (tr|A0A2G8I441|A0A2G8I441_PREIN) SMI1/KNR4 family protein {ECO:0000313|EMBL:PIK18296.1} KW=Complete proteome OX=28131 OS=Prevotella intermedia. GN=CTI16_03960 OC=Prevotella.
Sequence
MEFEQLEQQLTITELDNFEKSFSENIPIDFREHYLKYNGGYPPYENVKGLQNIFTINGFY
PIKYGRLPIEKIIKDYKNSGIDFNNKIPFAYDNGGNIFLISIETNTYGYVYIIEVNFLEE
KNYILVSKSFSDFLNSFY
Download sequence
Identical sequences A0A0D9NB11 A0A2G8I441
WP_045168223.1.67154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]