SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H1C280 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H1C280
Domain Number 1 Region: 1-99,164-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.000000000000221
Family Ankyrin repeat 0.0043
Further Details:      
 
Domain Number 2 Region: 254-296
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000051
Family SOCS box-like 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H1C280
Sequence length 333
Comment (tr|A0A2H1C280|A0A2H1C280_FASHE) Ankyrin repeat protein {ECO:0000313|EMBL:PIS81576.1} OX=6192 OS=Fasciola hepatica (Liver fluke). GN=D915_11507 OC=Fasciola.
Sequence
MMEAVSYNQREAVSLLVKQRDLDLYKRDFCTGDTALHIAVKKNYIHMVEILLQAGNWYIE
YNYNNLGESFVHDVVVYNRLELLRLFLAYNYDFDRPAKRFPPSLIGGAFTKSMYNSIPST
SVGSQDSSSNEAPCASASTSSCCGSLSYYGGVPGASRPNPMIFEKSPFQLALERGHLDMA
RILADVGCFRIRLPLNSNSSSHSPHVTTSPTSLSPTRAVSPNRLSQSSSHSHWTGLTGIS
MSSPLARRYSGLLEVKSLKKWCRRVIRQTLGFRLIEALPQLPLPVPLKDFLLLRDLDWSV
CLSSSLMNQRSVTDNGDLAIIVPPRCSSSLTPQ
Download sequence
Identical sequences A0A2H1C280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]