SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H2HWA1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H2HWA1
Domain Number 1 Region: 537-951
Classification Level Classification E-value
Superfamily DNA/RNA polymerases 9.45e-131
Family DNA polymerase I 0.00000487
Further Details:      
 
Domain Number 2 Region: 83-517
Classification Level Classification E-value
Superfamily Ribonuclease H-like 4.72e-93
Family DnaQ-like 3'-5' exonuclease 0.00093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H2HWA1
Sequence length 1081
Comment (tr|A0A2H2HWA1|A0A2H2HWA1_CAEJA) DNA polymerase {ECO:0000256|RuleBase:RU000442} KW=Complete proteome; Reference proteome OX=281687 OS=Caenorhabditis japonica. GN= OC=Rhabditoidea; Rhabditidae; Peloderinae; Caenorhabditis.
Sequence
MASKRAGGSSFQPDVKRKRESDEFEEFYVPKFENQLPAKLEIDKSTWARPKVDKQLGVTS
NIACQVLEVETYHVDGSATSYERTNVKLYGVTKAGNSICVIVTDYFPHFYFQAPQGFGVE
HIGTAQTALCNMVAAAKRRGGSGQAQLPGKVVDNLVHVELVRGENLYYYRGADSKVPFVK
ITGSTEALHKARMELKNGVNLMGKGPVNVGNLYESNINAVVMFLAKTGIVGCGWIEIPAG
KCEILSAAEKSSRCQIEVSVPVKNLIVHDSDGEWAGIAPIRTLSLDIECIGRRGVFPEAQ
KDPIIQIANLVKIEGESEPFVKNCFVLGTCAPVVGSNIYQCVNEKVLLEKWAEFVREVDP
DIITGYNILNFDLPYILDRAKVLSLPQVSHLGRQRDRGSVVRDATISSKQMGSRVNKSID
IHGRIIFDVLQVVLRDYKLRSYTLNSVSYQFLSEQKEDVEHNIIPDLQRGDEQTRRRLAQ
YCLKDALLPLRLLDKLMSIINYIEMARVTGVPMNFLLTKGQQIKILSMMLRRCKQQNFFL
PVIDASGGDGESYEGATVIDPIRGFYNEPIATLDFASLYPSIMIAHNLCYTTLLKAPQGV
ENEDYIRTPSGQFFATKSQRRGLLPEILEDILAARKRAKNDMKNEKDEFKRMVYNGRQLA
LKISANSVYGFTGATVGKLPCLEISQSVTAFGRKMIDMTKSEVERIYKKGALDGKCPADA
KVIYGDTDSVMVKFGVDTVAQAMEIGLHAAQEVSKVFTPPIKLEFEKVYFPYLLINKKRY
AGLYFTKPDVHDKMDCKGLETVRRDNCPLVAKVLGVCLERLLIDRDQQSALDFAKRTISD
LLCNKIDISLLIISKELTKSGDKYQAKQAHVELAARMKKRDAGSAPRLGDRVPYVFVAAA
KNVPAYERAEDPTFVLQNNIPLDTKHYLTNQLAKPLARIFEPILGDRAEKILVEGEHTRV
RTVVQSKVGGLAAFTKKSATCLGCKSVLPKMESENAVCKHCEPKLPAIFASRLTTMHELE
NHFGRLWTECQNCAKTMQDKVNCSARDCPIYYMREKVRNELAEASAVIDRFGDPCFTPPT
K
Download sequence
Identical sequences A0A2H2HWA1
281687.CJA01513 CJA01513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]