SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3B7X7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3B7X7
Domain Number 1 Region: 374-458
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000163
Family UBX domain 0.028
Further Details:      
 
Domain Number 2 Region: 190-279
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000559
Family Thioltransferase 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H3B7X7
Sequence length 557
Comment (tr|A0A2H3B7X7|A0A2H3B7X7_9AGAR) Uncharacterized protein {ECO:0000313|EMBL:PBK59963.1} KW=Complete proteome; Reference proteome OX=1076256 OS=Armillaria solidipes. GN=ARMSODRAFT_1090560 OC=Armillaria.
Sequence
MDGLTSSQLQALNQLRDLTNGGDDDVAIGVLSSVEWDVQRAADMIFGTGAGSAPSAPSRH
VEQFEVDDSQQGVDDDWPQRATFPSNPRPSALVSVLTYPLHILSSIFRFIFSVLRIPIPH
IPFLSLHFYRPLGNSRTSRGPDSWIRDLEEETGAVCIGRQSQSQGVASGVAGPSTLTARG
GGEDDGRKYLPDFLLGTYENTLRRCQKEAKIGCIVLVSEEHDDDAEFKRTTLTDPDFVNF
LTNNDFIVWGGDVRDLEAYSASEKLQASTYPFVAFVAIQPTRHSQSSSPPPTLTVLSRHQ
GLRETTAPKLLNHLQDNLIPRVQPYLERVRNSQRALERDRTLRQQQDQAFADTARRDKER
ILAKMAEEKRVEEERRAEERRVQEEAARQQKEIEERKKRESERMVWRRWARSALVKPENP
SDRLRIAVRLPEGQRLMRRFGTTDTLTALYAFVDREFIPAKYAVQDDPQSPPEAGDVESK
IEDMGGQRSWWGFTLHSAYPRVEVPWEPRKRLGDVACLKDGGGQLIVEVAGDKRRLSVGK
GKDKEDDGYDTEESDDE
Download sequence
Identical sequences A0A2H3B7X7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]