SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3IM34 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3IM34
Domain Number 1 Region: 389-432,463-503
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000000227
Family UBX domain 0.021
Further Details:      
 
Domain Number 2 Region: 165-312
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000000103
Family UAS domain 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3IM34
Sequence length 521
Comment (tr|A0A2H3IM34|A0A2H3IM34_9EURO) UAS {ECO:0000313|EMBL:PCH01143.1} KW=Complete proteome; Reference proteome OX=290292 OS=Penicillium occitanis. GN=PENO1_044450 OC=Eurotiomycetidae; Eurotiales; Aspergillaceae; Penicillium.
Sequence
MPQFHYCNDLNGMSRHAFDPSINRSGRLTDEQIAISKFFDGEGVDPVEEARAAMNAPPDI
RRTQNLMYDIDDLPPRASVSSHRPAGLEPAPRIETQPEDQPAFRPPFILSLIFSPLNLLY
RLLYNSFRLFGTLFPFLPRWLNVTTSSSPLQRNLNTSGRRALAPKDTAARFIREFEEEYG
SHALPFLENGYNMALEKAHQELKFLVVVLLSPEHDDMNGWVKETLLSRQVVEYINDPNNQ
ILLWGGNVQDSEAYQVANSLRCTKFPFASVIVHTPNVGSTAMSNIGRIPGNTSPSEFLTK
LRTAISQNKEPLDRVRARRTEQQASRTLRQEQDSAYERSLAQDRERARQRREAEAARQRA
EAEEAARLAMEEKRAADLKQWKQWRAQNLAPEPEGPDAIRVSIRLPSGERVIRKFAPEAD
LEEVYAFVECYEVLTAITAAAAEDEDEEERQTEKPVSQPVGFEHKYGFRLVSPMPRTVYE
VEGGGSVRERIGRGGNLLVEMIEEEDDEVSDEGEEEERNEM
Download sequence
Identical sequences A0A2H3IM34

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]