SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3JCE7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3JCE7
Domain Number 1 Region: 229-399
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.03e-38
Family Glutathione peroxidase-like 0.00023
Further Details:      
 
Domain Number 2 Region: 3-106
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.24e-28
Family PHBH-like 0.0000992
Further Details:      
 
Domain Number 3 Region: 100-191
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 9.86e-19
Family FAD-linked reductases, N-terminal domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A2H3JCE7
Sequence length 401
Comment (tr|A0A2H3JCE7|A0A2H3JCE7_WOLCO) Thioredoxin-like protein {ECO:0000313|EMBL:PCH36409.1} KW=Complete proteome; Reference proteome OX=742152 OS=Wolfiporia cocos (strain MD-104) (Brown rot fungus). GN=WOLCODRAFT_140401 OC=Agaricomycetes; Polyporales; Wolfiporia.
Sequence
MEGEQTDYIWGVLDFVPDTDLPDIRIFCAVHSHNGSCMVIPREGDTVRLYVQLSDADVQD
AATGRVDKSKFSPERLLDVARRSLSPFTIAAPRGVEWWTLYIIGQRVASKYSVQERVFIA
GDACHTHSPKAGQGMNASINDSHDLAWKLTHVIRGWAGLSLLKTYEFERRKYAQDLIAFD
KRWSALFSGKPRTDEDADGVTHEEFLEALKTSDQFMSGIGVYYAPSVLTRMTHQASAHGL
VIGQRLHPHIFVRAADARPVDIHDMLPADGRFGVAVFAGDADTHLATLAHSLDTLLRRHA
DQRGGVAAVFNVFTVLARSKDDVNYTDVPELLRPHWSKVLLDDTDMFGRSGGGGYDAYGI
DRARGAVVIVRPDGFVGTVAPLEDLSEIDEYFSSFMVETQS
Download sequence
Identical sequences A0A2H3JCE7
jgi|Wolco1|140401|estExt_fgenesh1_kg.C_140163

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]