SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H3XWI9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H3XWI9
Domain Number 1 Region: 37-215
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.02e-36
Family PAPS reductase-like 0.0016
Further Details:      
 
Domain Number 2 Region: 289-396
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.99e-19
Family PDI-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H3XWI9
Sequence length 399
Comment (tr|A0A2H3XWI9|A0A2H3XWI9_PHODC) 5'-adenylylsulfate reductase 3, chloroplastic-like {ECO:0000313|RefSeq:XP_008789819.1} KW=Complete proteome; Reference proteome OX=42345 OS=Phoenix dactylifera (Date palm). GN=LOC103707194 OC=Phoeniceae; Phoenix.
Sequence
MVAIIIAVGGSSSWTHFYLVLFIVGQPKYHIRSMLDKKIDLIGWIYLVSSPCGAEDVALI
EYARLTGRPFRVFSLDTGRLNPETYRFFDAVEKHYDIHIEYMFPDAVEVQALVRSKGLFS
FYEDGHQECCRVRKVRPLRRSLKGLRAWVTGQRKDQSPGTRAHIPVVQVDPSFEGMDGGI
GSLIKWNPVSNVEGKDIWNFLRTMDVPVNSLHSQGYVSIGCEPCTRPVLPGQHEREGRWW
WEDSKAKECGLHKGNIAQEEAQKLGTNGNGSAAVNHVNGAPDIFETQAIVNLSRPGMENL
LRLENRREPWLVVLYASWCPFCQGMEASYVELAEKLSDTGIKVGKFRADGDHKPFAQQQL
QLGSFPTILFFPKHASRPIKYPSERRDVDSLLAFINALR
Download sequence
Identical sequences A0A2H3XWI9
XP_008789819.1.81946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]