SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H4ZFW6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H4ZFW6
Domain Number 1 Region: 5-101,128-244
Classification Level Classification E-value
Superfamily PHP domain-like 1.04e-22
Family PHP domain 0.0082
Further Details:      
 
Domain Number 2 Region: 259-449,586-624,741-849
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.19e-21
Family ABC transporter ATPase domain-like 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A2H4ZFW6
Sequence length 891
Comment (tr|A0A2H4ZFW6|A0A2H4ZFW6_9BACT) PHP N-terminal domain protein {ECO:0000313|EMBL:AUF80108.1} OX=77133 OS=uncultured bacterium. GN= OC=Bacteria; environmental samples.
Sequence
MVGSRWYKFDFHNHTPASHDYKIPDISPREWLLAYMKQHVDCVVISDHNSGAWVDVLKGE
LENMSRDASTGDLPEFRPLTLFPGVELTATGNVHILAVLHTHSTSADVERLLAQCNNNSP
IPSEVPNHQLVLQLGPAGIISNIRRNPKAVCILAHIDAAKGVLSLTNQAELTAAFQESPH
AVEIRHRVEDITDGTRRRLIDNLPWLRGSDAHHPEQAGMRTCWLKMSSPDFDGLRHALLD
PENCVLFDQLPPEEPASYLRSLKFRTRHCHPVGQDSASVEFSPFYNAVIGSRGSGKSTLI
ESIRLAMRKTEGLTATQGSKLDQFIRTGMEADSFIECIFHKEGTDFRLSWRPDSKHELHI
FSDGEWMPDSHWSADRFPLSIYSQKMLYELASDTGAFLRVCDESPVVNKRAWKERWDQLE
REYLNEQITLRGLRARQGSADSLRGELSDAERAVSQLQSSAYYPVCRQLALARNELSAAT
LPLEHFERRIAAIQALAEEPLQRSDIPPEPSGLLMAFMARLSSVQQQYDQRLNTLLAEYA
AELAGIRREQSFIALRTAVSDQETNVESEAVSLRARGLNPDVLNELMARCESLKNELRNY
DGLDGAISASVARSEQLLAEMRAHRMALTDNRKAFLSSLSLSALEIKILPLCAPYEDVIS
GYQTVTGISNFAERIYDNSDGSGLLSDFISERPFSPLPAATEKKYRALDELKALHHSIRL
DNSEAGAGLHGSFRNRLRSLNDQQLDALQCWYPDDGIHIRYQTPGGQMEDIAFASPGQKG
ASMLQFLLSYGTDPLLLDQPEDDLDCLMLSMSVIPAIMSNKKRRQLIIVSHSAPIVVNGD
AEYVISMQHDRTGLYPGLCGALQEAPMKALICRQMEGGEKAFRSRYERILS
Download sequence
Identical sequences A0A0S4GAL0 A0A237JGZ2 A0A2A2XMY6 A0A2H4ZFW6 I1WZW2
WP_015059139.1.101289 WP_015059139.1.101734 WP_015059139.1.102075 WP_015059139.1.11499 WP_015059139.1.12944 WP_015059139.1.17216 WP_015059139.1.2362 WP_015059139.1.32023 WP_015059139.1.3215 WP_015059139.1.34782 WP_015059139.1.3640 WP_015059139.1.37750 WP_015059139.1.57159 WP_015059139.1.59042 WP_015059139.1.60830 WP_015059139.1.62452 WP_015059139.1.6640 WP_015059139.1.66795 WP_015059139.1.6803 WP_015059139.1.79092 WP_015059139.1.83941 WP_015059139.1.86234 WP_015059139.1.8832 WP_015059139.1.89255 WP_015059139.1.90270 WP_015059139.1.91213 WP_015059139.1.97273 gi|410609681|ref|YP_006953862.1|NC_019089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]