SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5NYG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5NYG2
Domain Number 1 Region: 33-212
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.57e-69
Family Inorganic pyrophosphatase 0.00000528
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H5NYG2
Sequence length 217
Comment (tr|A0A2H5NYG2|A0A2H5NYG2_CITUN) Uncharacterized protein {ECO:0000313|EMBL:GAY45167.1} OX=55188 OS=Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu). GN=CUMW_087480 OC=Citrus.
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVKYELDKKSGLIMVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPG
CFLRAKAIGLMPMIDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKN
ENKEVAVNDFLPASDAYNSVQQSMNLYADYIVESLRR
Download sequence
Identical sequences A0A2H5NYG2 V4URV0 W8Q8K1
XP_006429019.1.91645 XP_006480750.1.29302 clementine0.9_021454m|PACid:19260882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]