SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A2H5NYI4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A2H5NYI4
Domain Number 1 Region: 33-190
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 9.42e-58
Family Inorganic pyrophosphatase 0.000015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A2H5NYI4
Sequence length 191
Comment (tr|A0A2H5NYI4|A0A2H5NYI4_CITUN) Uncharacterized protein {ECO:0000313|EMBL:GAY45170.1} OX=55188 OS=Citrus unshiu (Satsuma mandarin) (Citrus nobilis var. unshiu). GN=CUMW_087480 OC=Citrus.
Sequence
MMAPPIETSSKTPVSQPPAHPPLNERILSSMSRRSVAAHPWHDLEIGPGAPKIFNCVIEI
GKGSKVDRVLYSSVVYPHNYGFIPRTLCEDNDPLDVLIIMQEPVLPGCFLRAKAIGLMPM
IDQGEKDDKIIAVCADDPEYRHYNDIKELPPHRLAEIRRFFEDYKKNENKEVAVNDFLPA
SDAYNSVQQSM
Download sequence
Identical sequences A0A067CZW1 A0A2H5NYI4
orange1.1g029548m|PACid:18103041

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]